SCOPe 2.08: Domain d1ztxl2: 1ztx L:108-212

Lineage for d1ztxl2 (1ztx L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d1ztxl2: 1ztx L:108-212 [197699]
   Other proteins in same PDB: d1ztxe_, d1ztxh1, d1ztxh2, d1ztxl1
   automated match to d1c12a2

Details for d1ztxl2

PDB Entry: 1ztx, 2.5 Å

PDB Description: West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab

PDB Compounds: (L:) Light Chain of E16 Antibody

SCOPe Domain Sequences for d1ztxl2:

Sequence; same for both SEQRES and ATOM records:

>d1ztxl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1ztxl2:

• d1ztxl2 first appeared in SCOPe 2.03
  
• d1ztxl2 appears in SCOPe 2.07