![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
![]() | Domain d1ztxl1: 1ztx L:1-107 [197698] Other proteins in same PDB: d1ztxe_, d1ztxh1, d1ztxh2, d1ztxl2 automated match to d1c12a1 |
PDB Entry: 1ztx (more details), 2.5 Å
SCOPe Domain Sequences for d1ztxl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztxl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliswastrhtgvpd rftgsgsgtdytltissvqaedlalyycqqhyttpltfgagtklelk
Timeline for d1ztxl1: