Lineage for d1ztxl1 (1ztx L:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297067Domain d1ztxl1: 1ztx L:1-107 [197698]
    Other proteins in same PDB: d1ztxe_, d1ztxh1, d1ztxl2
    automated match to d1c12a1

Details for d1ztxl1

PDB Entry: 1ztx (more details), 2.5 Å

PDB Description: West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab
PDB Compounds: (L:) Light Chain of E16 Antibody

SCOPe Domain Sequences for d1ztxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztxl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliswastrhtgvpd
rftgsgsgtdytltissvqaedlalyycqqhyttpltfgagtklelk

SCOPe Domain Coordinates for d1ztxl1:

Click to download the PDB-style file with coordinates for d1ztxl1.
(The format of our PDB-style files is described here.)

Timeline for d1ztxl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ztxl2