![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
![]() | Domain d1za6e2: 1za6 E:114-220 [197695] Other proteins in same PDB: d1za6a1, d1za6b1, d1za6b2, d1za6b3, d1za6c1, d1za6d1, d1za6d2, d1za6d3, d1za6e1, d1za6f1, d1za6f2, d1za6f3, d1za6g1, d1za6h1, d1za6h2, d1za6h3 automated match to d1rhha2 |
PDB Entry: 1za6 (more details), 2.8 Å
SCOPe Domain Sequences for d1za6e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za6e2 b.1.1.2 (E:114-220) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1za6e2: