| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (19 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
| Domain d1za6e1: 1za6 E:1-113 [197694] Other proteins in same PDB: d1za6a2, d1za6b1, d1za6b2, d1za6b3, d1za6c2, d1za6d1, d1za6d2, d1za6d3, d1za6e2, d1za6f1, d1za6f2, d1za6f3, d1za6g2, d1za6h1, d1za6h2, d1za6h3 automated match to d1rhha1 |
PDB Entry: 1za6 (more details), 2.8 Å
SCOPe Domain Sequences for d1za6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1za6e1 b.1.1.0 (E:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmsqspdslavslgervtlnckssqsllysgnqknylawyqqkpgqspklliywasar
esgvpdrfsgsgsgtdftltissvqaedvavyycqqyysypltfgagtklelk
Timeline for d1za6e1: