Lineage for d1za6a1 (1za6 A:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758176Domain d1za6a1: 1za6 A:1-113 [197690]
    Other proteins in same PDB: d1za6a2, d1za6b1, d1za6b2, d1za6b3, d1za6c2, d1za6d1, d1za6d2, d1za6d3, d1za6e2, d1za6f1, d1za6f2, d1za6f3, d1za6g2, d1za6h1, d1za6h2, d1za6h3
    automated match to d1rhha1

Details for d1za6a1

PDB Entry: 1za6 (more details), 2.8 Å

PDB Description: The structure of an antitumor CH2-domain-deleted humanized antibody
PDB Compounds: (A:) IGG Light chain

SCOPe Domain Sequences for d1za6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za6a1 b.1.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmsqspdslavslgervtlnckssqsllysgnqknylawyqqkpgqspklliywasar
esgvpdrfsgsgsgtdftltissvqaedvavyycqqyysypltfgagtklelk

SCOPe Domain Coordinates for d1za6a1:

Click to download the PDB-style file with coordinates for d1za6a1.
(The format of our PDB-style files is described here.)

Timeline for d1za6a1: