SCOPe 2.08: Domain d1za6a1: 1za6 A:1-113

Lineage for d1za6a1 (1za6 A:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d1za6a1: 1za6 A:1-113 [197690]
   Other proteins in same PDB: d1za6a2, d1za6b1, d1za6b2, d1za6b3, d1za6c2, d1za6d1, d1za6d2, d1za6d3, d1za6e2, d1za6f1, d1za6f2, d1za6f3, d1za6g2, d1za6h1, d1za6h2, d1za6h3
   automated match to d1rhha1

Details for d1za6a1

PDB Entry: 1za6, 2.8 Å

PDB Description: The structure of an antitumor CH2-domain-deleted humanized antibody

PDB Compounds: (A:) IGG Light chain

SCOPe Domain Sequences for d1za6a1:

Sequence; same for both SEQRES and ATOM records:

>d1za6a1 b.1.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmsqspdslavslgervtlnckssqsllysgnqknylawyqqkpgqspklliywasar
esgvpdrfsgsgsgtdftltissvqaedvavyycqqyysypltfgagtklelk

Timeline for d1za6a1:

• d1za6a1 first appeared in SCOPe 2.03
  
• d1za6a1 appears in SCOPe 2.07