| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
| Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [141178] (1 species) |
| Species Pseudomonas putida [TaxId:303] [141179] (3 PDB entries) Uniprot O05935 16-163 |
| Domain d1z01c1: 1z01 C:16-163 [197675] Other proteins in same PDB: d1z01a2, d1z01b2, d1z01c2, d1z01d2, d1z01e2, d1z01f2 automated match to d1z01a1 complexed with fe, fes |
PDB Entry: 1z01 (more details), 1.8 Å
SCOPe Domain Sequences for d1z01c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z01c1 b.33.1.2 (C:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
vttypvhevngmifvfvreddfpdedvp
Timeline for d1z01c1: