Lineage for d1yy9c1 (1yy9 C:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297145Domain d1yy9c1: 1yy9 C:1-107 [197671]
    Other proteins in same PDB: d1yy9a1, d1yy9a2, d1yy9a3, d1yy9a4
    automated match to d1f3dj1
    complexed with nag, ndg

Details for d1yy9c1

PDB Entry: 1yy9 (more details), 2.6 Å

PDB Description: Structure of the extracellular domain of the epidermal growth factor receptor in complex with the Fab fragment of cetuximab/Erbitux/IMC-C225
PDB Compounds: (C:) Cetuximab Fab Light chain

SCOPe Domain Sequences for d1yy9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yy9c1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk

SCOPe Domain Coordinates for d1yy9c1:

Click to download the PDB-style file with coordinates for d1yy9c1.
(The format of our PDB-style files is described here.)

Timeline for d1yy9c1: