![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48750] (1 PDB entry) |
![]() | Domain d1igtd1: 1igt D:1-114 [19767] Other proteins in same PDB: d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc2, d1igtd2, d1igtd3, d1igtd4 complexed with fuc, gal, man, nag |
PDB Entry: 1igt (more details), 2.8 Å
SCOP Domain Sequences for d1igtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtd1 b.1.1.1 (D:1-114) Immunoglobulin (variable domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain} evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssa
Timeline for d1igtd1: