Lineage for d1igtd1 (1igt D:1-114)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220084Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48750] (1 PDB entry)
  8. 220088Domain d1igtd1: 1igt D:1-114 [19767]
    Other proteins in same PDB: d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc2, d1igtd2, d1igtd3, d1igtd4
    complexed with fuc, gal, man, nag

Details for d1igtd1

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd1 b.1.1.1 (D:1-114) Immunoglobulin (variable domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssa

SCOP Domain Coordinates for d1igtd1:

Click to download the PDB-style file with coordinates for d1igtd1.
(The format of our PDB-style files is described here.)

Timeline for d1igtd1: