Lineage for d1igtd1 (1igt D:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7960Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48750] (1 PDB entry)
  8. 7964Domain d1igtd1: 1igt D:1-114 [19767]
    Other proteins in same PDB: d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc2, d1igtd2, d1igtd3, d1igtd4

Details for d1igtd1

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd1 b.1.1.1 (D:1-114) Immunoglobulin (variable domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssa

SCOP Domain Coordinates for d1igtd1:

Click to download the PDB-style file with coordinates for d1igtd1.
(The format of our PDB-style files is described here.)

Timeline for d1igtd1: