SCOPe 2.08: Domain d1ymha1: 1ymh A:1-107

Lineage for d1ymha1 (1ymh A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d1ymha1: 1ymh A:1-107 [197663]
   Other proteins in same PDB: d1ymha2, d1ymhb1, d1ymhb2, d1ymhc2, d1ymhd1, d1ymhd2, d1ymhe_, d1ymhf_
   automated match to d1nlbl1
   mutant

Details for d1ymha1

PDB Entry: 1ymh, 2.6 Å

PDB Description: anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W

PDB Compounds: (A:) Fab 16D9D6, light chain

SCOPe Domain Sequences for d1ymha1:

Sequence; same for both SEQRES and ATOM records:

>d1ymha1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk

Timeline for d1ymha1:

• d1ymha1 first appeared in SCOPe 2.03
  
• d1ymha1 appears in SCOPe 2.07