Lineage for d1igtc1 (1igt C:1-108)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158495Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48750] (1 PDB entry)
  8. 158498Domain d1igtc1: 1igt C:1-108 [19766]
    Other proteins in same PDB: d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc2, d1igtd2, d1igtd3, d1igtd4

Details for d1igtc1

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps
rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikr

SCOP Domain Coordinates for d1igtc1:

Click to download the PDB-style file with coordinates for d1igtc1.
(The format of our PDB-style files is described here.)

Timeline for d1igtc1: