SCOP 1.55: Domain d1igtc1: 1igt C:1-108

Lineage for d1igtc1 (1igt C:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48750] (1 PDB entry)

8. Domain d1igtc1: 1igt C:1-108 [19766]
   Other proteins in same PDB: d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc2, d1igtd2, d1igtd3, d1igtd4

Details for d1igtc1

PDB Entry: 1igt, 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtc1:

Sequence; same for both SEQRES and ATOM records:

>d1igtc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps
rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikr

Timeline for d1igtc1:

• d1igtc1 appears in SCOP 1.57
  
• d1igtc1 appears in the current release, SCOPe 2.08