Lineage for d1xi1b2 (1xi1 B:188-575)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2246834Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2247078Protein phi29 DNA polymerase [118193] (1 species)
  7. 2247079Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
    Uniprot P03680
  8. 2247090Domain d1xi1b2: 1xi1 B:188-575 [197655]
    Other proteins in same PDB: d1xi1a1, d1xi1b1
    automated match to d1xhxa2
    protein/DNA complex; complexed with mg

Details for d1xi1b2

PDB Entry: 1xi1 (more details), 2.2 Å

PDB Description: phi29 dna polymerase ssdna complex, monoclinic crystal form
PDB Compounds: (B:) DNA polymerase

SCOPe Domain Sequences for d1xi1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xi1b2 e.8.1.1 (B:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d1xi1b2:

Click to download the PDB-style file with coordinates for d1xi1b2.
(The format of our PDB-style files is described here.)

Timeline for d1xi1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xi1b1