Lineage for d1xi1b1 (1xi1 B:5-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886652Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. 2886653Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
    Uniprot P03680
  8. 2886672Domain d1xi1b1: 1xi1 B:5-187 [197654]
    Other proteins in same PDB: d1xi1a2, d1xi1b2
    automated match to d1xhxa1
    protein/DNA complex; complexed with mg

Details for d1xi1b1

PDB Entry: 1xi1 (more details), 2.2 Å

PDB Description: phi29 dna polymerase ssdna complex, monoclinic crystal form
PDB Compounds: (B:) DNA polymerase

SCOPe Domain Sequences for d1xi1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xi1b1 c.55.3.5 (B:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

SCOPe Domain Coordinates for d1xi1b1:

Click to download the PDB-style file with coordinates for d1xi1b1.
(The format of our PDB-style files is described here.)

Timeline for d1xi1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xi1b2