Lineage for d1xhzd2 (1xhz D:188-575)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. Protein phi29 DNA polymerase [118193] (1 species)
  7. Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
    Uniprot P03680
  8. Domain d1xhzd2: 1xhz D:188-575 [197653]
    Other proteins in same PDB: d1xhza1, d1xhzb1, d1xhzc1, d1xhzd1
    automated match to d1xhxa2
    protein/DNA complex

Details for d1xhzd2

PDB Entry: 1xhz (more details), 2.7 Å

PDB Description: Phi29 DNA polymerase, orthorhombic crystal form, ssDNA complex
PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d1xhzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhzd2 e.8.1.1 (D:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d1xhzd2 are not available.

Timeline for d1xhzd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhzd1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xhza1, d1xhza2, d1xhzb1, d1xhzb2, d1xhzc1, d1xhzc2