Lineage for d1xhzd1 (1xhz D:5-187)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. Protein Exonuclease domain of phi29 DNA polymerase [117650] (1 species)
  7. Species Bacteriophage phi-29 [TaxId:10756] [117651] (8 PDB entries)
    Uniprot P03680
  8. Domain d1xhzd1: 1xhz D:5-187 [197652]
    Other proteins in same PDB: d1xhza2, d1xhzb2, d1xhzc2, d1xhzd2
    automated match to d1xhxa1
    protein/DNA complex

Details for d1xhzd1

PDB Entry: 1xhz (more details), 2.7 Å

PDB Description: Phi29 DNA polymerase, orthorhombic crystal form, ssDNA complex
PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d1xhzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhzd1 c.55.3.5 (D:5-187) Exonuclease domain of phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
ldr

SCOPe Domain Coordinates for d1xhzd1 are not available.

Timeline for d1xhzd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xhzd2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xhza1, d1xhza2, d1xhzb1, d1xhzb2, d1xhzc1, d1xhzc2