| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (61 PDB entries) Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10 |
| Domain d1igtb1: 1igt B:1-114 [19765] Other proteins in same PDB: d1igta1, d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc1, d1igtc2, d1igtd2, d1igtd3, d1igtd4 part of intact IgG2a antibody Mab231 |
PDB Entry: 1igt (more details), 2.8 Å
SCOPe Domain Sequences for d1igtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssa
Timeline for d1igtb1: