Lineage for d1igtb1 (1igt B:1-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740131Domain d1igtb1: 1igt B:1-114 [19765]
    Other proteins in same PDB: d1igta1, d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc1, d1igtc2, d1igtd2, d1igtd3, d1igtd4
    part of intact IgG2a antibody Mab231

Details for d1igtb1

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (B:) igg2a intact antibody - mab231

SCOPe Domain Sequences for d1igtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evklqesggglvqpggslklscatsgftfsdyymywvrqtpekrlewvayisngggstyy
pdtvkgrftisrdnakntlylqmsrlksedtamyycarhggyyamdywgqgttvtvssa

SCOPe Domain Coordinates for d1igtb1:

Click to download the PDB-style file with coordinates for d1igtb1.
(The format of our PDB-style files is described here.)

Timeline for d1igtb1: