Lineage for d1xhxc2 (1xhx C:188-575)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622316Protein phi29 DNA polymerase [118193] (1 species)
  7. 2622317Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries)
    Uniprot P03680
  8. 2622325Domain d1xhxc2: 1xhx C:188-575 [197645]
    Other proteins in same PDB: d1xhxa1, d1xhxb1, d1xhxc1, d1xhxd1
    automated match to d1xhxa2
    complexed with mg, so4

Details for d1xhxc2

PDB Entry: 1xhx (more details), 2.35 Å

PDB Description: phi29 dna polymerase, orthorhombic crystal form
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d1xhxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhxc2 e.8.1.1 (C:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]}
mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv
fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs
rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw
tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt
pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes
tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk
vgfsrkmkpkpvqvpggvvlvddtftik

SCOPe Domain Coordinates for d1xhxc2:

Click to download the PDB-style file with coordinates for d1xhxc2.
(The format of our PDB-style files is described here.)

Timeline for d1xhxc2: