Lineage for d1xgua1 (1xgu A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740776Species Escherichia coli [TaxId:562] [224853] (1 PDB entry)
  8. 2740777Domain d1xgua1: 1xgu A:1-107 [197640]
    Other proteins in same PDB: d1xgua2, d1xgub_, d1xguc_
    automated match to d1nbya1
    mutant

Details for d1xgua1

PDB Entry: 1xgu (more details), 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33F mutant complexed with hen egg lysozyme
PDB Compounds: (A:) antibody kappa light chain

SCOPe Domain Sequences for d1xgua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgua1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Escherichia coli [TaxId: 562]}
divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOPe Domain Coordinates for d1xgua1:

Click to download the PDB-style file with coordinates for d1xgua1.
(The format of our PDB-style files is described here.)

Timeline for d1xgua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgua2