Lineage for d1xgta1 (1xgt A:0-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295867Species Escherichia coli [TaxId:562] [224856] (13 PDB entries)
  8. 1295878Domain d1xgta1: 1xgt A:0-107 [197638]
    Other proteins in same PDB: d1xgta2, d1xgtc_
    automated match to d1dqdl1
    mutant

Details for d1xgta1

PDB Entry: 1xgt (more details), 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33L mutant complexed with hen egg lysozyme
PDB Compounds: (A:) HyHEL-63

SCOPe Domain Sequences for d1xgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgta1 b.1.1.0 (A:0-107) automated matches {Escherichia coli [TaxId: 562]}
mdivltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgip
srfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOPe Domain Coordinates for d1xgta1:

Click to download the PDB-style file with coordinates for d1xgta1.
(The format of our PDB-style files is described here.)

Timeline for d1xgta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgta2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xgtc_