SCOPe 2.05: Domain d1xgpa1: 1xgp A:0-107

Lineage for d1xgpa1 (1xgp A:0-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d1xgpa1: 1xgp A:0-107 [197632]
   Other proteins in same PDB: d1xgpa2, d1xgpc_
   automated match to d1dqdl1
   mutant

Details for d1xgpa1

PDB Entry: 1xgp, 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33A mutant complexed with hen egg lysozyme

PDB Compounds: (A:) antibody kappa light chain

SCOPe Domain Sequences for d1xgpa1:

Sequence; same for both SEQRES and ATOM records:

>d1xgpa1 b.1.1.0 (A:0-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdivltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgip
srfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1xgpa1:

• d1xgpa1 first appeared in SCOPe 2.03
  
• d1xgpa1 appears in SCOPe 2.04
  
• d1xgpa1 appears in SCOPe 2.06
  
• d1xgpa1 appears in the current release, SCOPe 2.08