SCOPe 2.06: Domain d1f97a1: 1f97 A:27-128

Lineage for d1f97a1 (1f97 A:27-128)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Junction adhesion molecule, JAM, N-terminal domain [48747] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48748] (1 PDB entry)

8. Domain d1f97a1: 1f97 A:27-128 [19763]
   Other proteins in same PDB: d1f97a2
   complexed with mg

Details for d1f97a1

PDB Entry: 1f97, 2.5 Å

PDB Description: soluble part of the junction adhesion molecule from mouse

PDB Compounds: (A:) junction adhesion molecule

SCOPe Domain Sequences for d1f97a1:

Sequence; same for both SEQRES and ATOM records:

>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
kgsvytaqsdvqvpenesikltctysgfssprvewkfvqgsttalvcynsqitapyadrv
tfsssgitfssvtrkdngeytcmvseeggqnygevsihltvl

Timeline for d1f97a1:

• d1f97a1 first appeared (with stable ids) in SCOP 1.55
  
• d1f97a1 appears in SCOPe 2.05
  
• d1f97a1 appears in SCOPe 2.07
  
• d1f97a1 appears in the current release, SCOPe 2.08