Lineage for d1f97a1 (1f97 A:27-128)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein Junction adhesion molecule, JAM, N-terminal domain [48747] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [48748] (1 PDB entry) 
Domain d1f97a1: 1f97 A:27-128 [19763]
Other proteins in same PDB: d1f97a2
Details for d1f97a1
PDB Entry: 1f97 (more details), 2.5 Å
PDB Description: soluble part of the junction adhesion molecule from mouse
SCOP Domain Sequences for d1f97a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus)}
kgsvytaqsdvqvpenesikltctysgfssprvewkfvqgsttalvcynsqitapyadrv
tfsssgitfssvtrkdngeytcmvseeggqnygevsihltvl
SCOP Domain Coordinates for d1f97a1:
Click to download the PDB-style file with coordinates for d1f97a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f97a1:
- d1f97a1 appears in SCOP 1.57
- d1f97a1 appears in the current release, SCOPe 2.08
View in 3D
