![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Junction adhesion molecule, JAM, N-terminal domain [48747] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [48748] (1 PDB entry) |
![]() | Domain d1f97a1: 1f97 A:27-128 [19763] Other proteins in same PDB: d1f97a2 complexed with mg |
PDB Entry: 1f97 (more details), 2.5 Å
SCOPe Domain Sequences for d1f97a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} kgsvytaqsdvqvpenesikltctysgfssprvewkfvqgsttalvcynsqitapyadrv tfsssgitfssvtrkdngeytcmvseeggqnygevsihltvl
Timeline for d1f97a1: