Lineage for d1f97a1 (1f97 A:27-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741800Protein Junction adhesion molecule, JAM, N-terminal domain [48747] (2 species)
  7. 2741804Species Mouse (Mus musculus) [TaxId:10090] [48748] (1 PDB entry)
  8. 2741805Domain d1f97a1: 1f97 A:27-128 [19763]
    Other proteins in same PDB: d1f97a2
    complexed with mg

Details for d1f97a1

PDB Entry: 1f97 (more details), 2.5 Å

PDB Description: soluble part of the junction adhesion molecule from mouse
PDB Compounds: (A:) junction adhesion molecule

SCOPe Domain Sequences for d1f97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
kgsvytaqsdvqvpenesikltctysgfssprvewkfvqgsttalvcynsqitapyadrv
tfsssgitfssvtrkdngeytcmvseeggqnygevsihltvl

SCOPe Domain Coordinates for d1f97a1:

Click to download the PDB-style file with coordinates for d1f97a1.
(The format of our PDB-style files is described here.)

Timeline for d1f97a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f97a2