Lineage for d1wp9b2 (1wp9 B:201-487)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870825Protein putative ATP-dependent RNA helicase PF2015, C-terminal domain [419077] (1 species)
    separate structures of other domains are known: the middle nuclease domain (89718) and the C-terminal RuvA-like HhH domain (PDB 1x2i)
  7. 2870826Species Pyrococcus furiosus [TaxId:2261] [419577] (1 PDB entry)
    Uniprot Q8TZH8
  8. 2870828Domain d1wp9b2: 1wp9 B:201-487 [197622]
    Other proteins in same PDB: d1wp9a1, d1wp9b1, d1wp9c1, d1wp9d1, d1wp9e1, d1wp9f1
    automated match to d1wp9a2
    complexed with po4

Details for d1wp9b2

PDB Entry: 1wp9 (more details), 2.9 Å

PDB Description: crystal structure of pyrococcus furiosus hef helicase domain
PDB Compounds: (B:) ATP-dependent RNA helicase, putative

SCOPe Domain Sequences for d1wp9b2:

Sequence, based on SEQRES records: (download)

>d1wp9b2 c.37.1.19 (B:201-487) putative ATP-dependent RNA helicase PF2015, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
girfewvrvdlpeiykevrkllremlrdalkplaetgllessspdipkkevlragqiine
emakgnhdlrglllyhamalklhhaielletqglsalrayikklyeeakagstkaskeif
sdkrmkkaisllvqakeigldhpkmdklkeiireqlqrkqnskiivftnyretakkivne
lvkdgikakrfvgqaskendrglsqreqklildefargefnvlvatsvgeegldvpevdl
vvfyepvpsairsiqrrgrtgrhmpgrviilmakgtrdeayywssrq

Sequence, based on observed residues (ATOM records): (download)

>d1wp9b2 c.37.1.19 (B:201-487) putative ATP-dependent RNA helicase PF2015, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
girfewvrvdlpeiykevrkllremlrdalkplaetgllessspdipkkevlragqiine
emakgnhdlrglllyhamalklhhaielletqglsalrayikklyeeakagstkaskeif
sdkrmkkaisllvqakeigldhpkmdklkeiireqlqrkqnskiivftnyretakkivne
lvkdgikakrfvgsqreqklildefargefnvlvatsvgeegldvpevdlvvfyepvpsa
irsiqrrgrtgrhmpgrviilmakgtrdeayywssrq

SCOPe Domain Coordinates for d1wp9b2:

Click to download the PDB-style file with coordinates for d1wp9b2.
(The format of our PDB-style files is described here.)

Timeline for d1wp9b2: