SCOPe 2.05: Domain d1w4ve_: 1w4v E:

Lineage for d1w4ve_ (1w4v E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)

8. Domain d1w4ve_: 1w4v E: [197620]
   automated match to d1w4vf_

Details for d1w4ve_

PDB Entry: 1w4v, 1.8 Å

PDB Description: structure of the oxidised form of human thioredoxin 2

PDB Compounds: (E:) thioredoxin, mitochondrial

SCOPe Domain Sequences for d1w4ve_:

Sequence; same for both SEQRES and ATOM records:

>d1w4ve_ c.47.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig

Timeline for d1w4ve_:

• d1w4ve_ first appeared in SCOPe 2.03
  
• d1w4ve_ appears in SCOPe 2.04
  
• d1w4ve_ is called d1w4ve1 in SCOPe 2.06
  
• d1w4ve_ appears in the current release, SCOPe 2.08, called d1w4ve1