Lineage for d1dr9a1 (1dr9 A:1-105)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51679Protein CD80, N-terminal domain [48745] (1 species)
  7. 51680Species Human (Homo sapiens) [TaxId:9606] [48746] (2 PDB entries)
  8. 51681Domain d1dr9a1: 1dr9 A:1-105 [19762]
    Other proteins in same PDB: d1dr9a2

Details for d1dr9a1

PDB Entry: 1dr9 (more details), 3 Å

PDB Description: crystal structure of a soluble form of b7-1 (cd80)

SCOP Domain Sequences for d1dr9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens)}
vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvk

SCOP Domain Coordinates for d1dr9a1:

Click to download the PDB-style file with coordinates for d1dr9a1.
(The format of our PDB-style files is described here.)

Timeline for d1dr9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dr9a2