Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries) |
Domain d1w4vd1: 1w4v D:1-107 [197619] Other proteins in same PDB: d1w4va2, d1w4vb2, d1w4vd2, d1w4ve2, d1w4vf2 automated match to d1w4vf_ |
PDB Entry: 1w4v (more details), 1.8 Å
SCOPe Domain Sequences for d1w4vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w4vd1 c.47.1.0 (D:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdid dhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
Timeline for d1w4vd1: