SCOPe 2.06: Domain d1w4vd1: 1w4v D:1-107

Lineage for d1w4vd1 (1w4v D:1-107)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)

8. Domain d1w4vd1: 1w4v D:1-107 [197619]
   Other proteins in same PDB: d1w4va2, d1w4vb2, d1w4vd2, d1w4ve2, d1w4vf2
   automated match to d1w4vf_

Details for d1w4vd1

PDB Entry: 1w4v, 1.8 Å

PDB Description: structure of the oxidised form of human thioredoxin 2

PDB Compounds: (D:) thioredoxin, mitochondrial

SCOPe Domain Sequences for d1w4vd1:

Sequence; same for both SEQRES and ATOM records:

>d1w4vd1 c.47.1.0 (D:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdid
dhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig

Timeline for d1w4vd1:

• d1w4vd1 first appeared in SCOPe 2.03, called d1w4vd_
  
• d1w4vd1 was called d1w4vd_ in SCOPe 2.05
  
• d1w4vd1 appears in SCOPe 2.07
  
• d1w4vd1 appears in the current release, SCOPe 2.08