Lineage for d1ci5a1 (1ci5 A:1-95)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7016Protein CD2-binding domain of CD58, first domain [48743] (1 species)
  7. 7017Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)
  8. 7021Domain d1ci5a1: 1ci5 A:1-95 [19761]

Details for d1ci5a1

PDB Entry: 1ci5 (more details)

PDB Description: glycan-free mutant adhesion domain of human cd58 (lfa-3)

SCOP Domain Sequences for d1ci5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci5a1 b.1.1.1 (A:1-95) CD2-binding domain of CD58, first domain {Human (Homo sapiens)}
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges

SCOP Domain Coordinates for d1ci5a1:

Click to download the PDB-style file with coordinates for d1ci5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ci5a1: