Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.7: Satellite viruses [88650] (1 family) |
Family b.121.7.1: Satellite viruses [88651] (3 proteins) |
Protein STNV coat protein [49621] (1 species) |
Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (5 PDB entries) |
Domain d1vtzp_: 1vtz p: [197605] Other proteins in same PDB: d1vtz5_, d1vtz7_, d1vtzk_ automated match to d2buka_ complexed with ca |
PDB Entry: 1vtz (more details), 1.45 Å
SCOPe Domain Sequences for d1vtzp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtzp_ b.121.7.1 (p:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]} tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav ytda
Timeline for d1vtzp_:
View in 3D Domains from other chains: (mouse over for more information) d1vtz0_, d1vtz1_, d1vtz2_, d1vtz3_, d1vtz4_, d1vtz5_, d1vtz6_, d1vtz7_, d1vtze_, d1vtzf_, d1vtzg_, d1vtzh_, d1vtzi_, d1vtzj_, d1vtzk_, d1vtzl_, d1vtzm_, d1vtzn_, d1vtzo_, d1vtzq_, d1vtzr_, d1vtzs_, d1vtzt_, d1vtzu_, d1vtzv_, d1vtzw_, d1vtzx_, d1vtzy_, d1vtzz_ |