Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries) |
Domain d1qa9d_: 1qa9 D: [19760] Other proteins in same PDB: d1qa9a_, d1qa9c_ |
PDB Entry: 1qa9 (more details), 3.2 Å
SCOP Domain Sequences for d1qa9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qa9d_ b.1.1.1 (D:) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens)} ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg sltiynltssdedeyemespnitdsmkfflyvges
Timeline for d1qa9d_: