Lineage for d1vtz3_ (1vtz 3:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1335462Superfamily b.121.7: Satellite viruses [88650] (1 family) (S)
  5. 1335463Family b.121.7.1: Satellite viruses [88651] (3 proteins)
  6. 1335471Protein STNV coat protein [49621] (1 species)
  7. 1335472Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (5 PDB entries)
  8. 1335476Domain d1vtz3_: 1vtz 3: [197592]
    Other proteins in same PDB: d1vtz5_, d1vtz7_, d1vtzk_
    automated match to d2buka_
    complexed with ca

Details for d1vtz3_

PDB Entry: 1vtz (more details), 1.45 Å

PDB Description: 1.45 Angstrom Structure of STNV coat protein (half of the capsid, the other half in PDB 3RQV)
PDB Compounds: (3:) coat protein

SCOPe Domain Sequences for d1vtz3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vtz3_ b.121.7.1 (3:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda

SCOPe Domain Coordinates for d1vtz3_:

Click to download the PDB-style file with coordinates for d1vtz3_.
(The format of our PDB-style files is described here.)

Timeline for d1vtz3_: