| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries) |
| Domain d1qa9b_: 1qa9 B: [19759] Other proteins in same PDB: d1qa9a_, d1qa9c_ |
PDB Entry: 1qa9 (more details), 3.2 Å
SCOP Domain Sequences for d1qa9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qa9b_ b.1.1.1 (B:) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens)}
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges
Timeline for d1qa9b_: