Lineage for d1ccza1 (1ccz A:1-93)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries) 
Domain d1ccza1: 1ccz A:1-93 [19758]
Other proteins in same PDB: d1ccza2
complexed with nag
Details for d1ccza1
PDB Entry: 1ccz (more details), 1.8 Å
PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution
PDB Compounds: (A:) protein (cd58)SCOPe Domain Sequences for d1ccza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fsqqiygvvygnvtfhvpsnvplkevlwkkqkdkvaelensefrafssfknrvyldtvsg
sltiynltssdedeyemespnitdtmkfflyvl
SCOPe Domain Coordinates for d1ccza1:
Click to download the PDB-style file with coordinates for d1ccza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccza1:
- d1ccza1 first appeared (with stable ids) in SCOP 1.55
- d1ccza1 appears in SCOPe 2.07
View in 3D
