SCOPe 2.03: Domain d1uywl1: 1uyw L:1-107

Lineage for d1uywl1 (1uyw L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)

8. Domain d1uywl1: 1uyw L:1-107 [197579]
   Other proteins in same PDB: d1uywh1, d1uywl2, d1uywm1, d1uywn2
   automated match to d1kcul1

Details for d1uywl1

PDB Entry: 1uyw, 2 Å

PDB Description: crystal structure of the antiflavivirus fab4g2

PDB Compounds: (L:) fab antibody light chain

SCOPe Domain Sequences for d1uywl1:

Sequence; same for both SEQRES and ATOM records:

>d1uywl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqgysypytfgggtklelk

Timeline for d1uywl1:

• d1uywl1 is new in SCOPe 2.03-stable
  
• d1uywl1 appears in SCOPe 2.04
  
• d1uywl1 appears in the current release, SCOPe 2.08