Lineage for d1a7bd_ (1a7b D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein CD2, first domain [48740] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries) 
Domain d1a7bd_: 1a7b D: [19757]
Details for d1a7bd_
PDB Entry: 1a7b (more details), 3.1 Å
PDB Description: engineering a misfolded form of cd2
SCOP Domain Sequences for d1a7bd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7bd_ b.1.1.1 (D:) CD2, first domain {Rat (Rattus norvegicus)}
tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
nltrddsgtynvtvystngtrildkaldlrile
SCOP Domain Coordinates for d1a7bd_:
Click to download the PDB-style file with coordinates for d1a7bd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a7bd_:
- d1a7bd_ appears in SCOP 1.57
- d1a7bd_ appears in the current release, SCOPe 2.08
View in 3D
