Lineage for d1upmo2 (1upm O:148-475)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824891Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1824892Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1824893Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1824991Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (10 PDB entries)
  8. 1825029Domain d1upmo2: 1upm O:148-475 [197566]
    Other proteins in same PDB: d1upmb1, d1upmc_, d1upme1, d1upmf_, d1upmh1, d1upmi_, d1upmk1, d1upml1, d1upmm_, d1upmo1, d1upmp_, d1upmr1, d1upms_, d1upmt_, d1upmv1, d1upmw_
    automated match to d8ruca1
    complexed with ca, cap

Details for d1upmo2

PDB Entry: 1upm (more details), 2.3 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
PDB Compounds: (O:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1upmo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upmo2 c.1.14.1 (O:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d1upmo2:

Click to download the PDB-style file with coordinates for d1upmo2.
(The format of our PDB-style files is described here.)

Timeline for d1upmo2: