Lineage for d1u1qa2 (1u1q A:99-190)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652276Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 1652277Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
    Uniprot P09651 7-188
  8. 1652281Domain d1u1qa2: 1u1q A:99-190 [197552]
    protein/DNA complex; protein/RNA complex

Details for d1u1qa2

PDB Entry: 1u1q (more details), 1.8 Å

PDB Description: crystal structure of up1 complexed with d(ttagggtta(di)gg); a human telomeric repeat containing inosine
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1u1qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1qa2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkalskqemasas

SCOPe Domain Coordinates for d1u1qa2:

Click to download the PDB-style file with coordinates for d1u1qa2.
(The format of our PDB-style files is described here.)

Timeline for d1u1qa2: