Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries) Uniprot P09651 7-188 |
Domain d1u1qa2: 1u1q A:99-190 [197552] protein/DNA complex; protein/RNA complex |
PDB Entry: 1u1q (more details), 1.8 Å
SCOPe Domain Sequences for d1u1qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1qa2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds vdkiviqkyhtvnghncevrkalskqemasas
Timeline for d1u1qa2: