Lineage for d1u1qa1 (1u1q A:8-98)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
    Uniprot P09651 7-188
  8. Domain d1u1qa1: 1u1q A:8-98 [197551]
    protein/DNA complex; protein/RNA complex

Details for d1u1qa1

PDB Entry: 1u1q (more details), 1.8 Å

PDB Description: crystal structure of up1 complexed with d(ttagggtta(di)gg); a human telomeric repeat containing inosine
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1u1qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1qa1 d.58.7.1 (A:8-98) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrp

SCOPe Domain Coordinates for d1u1qa1 are not available.

Timeline for d1u1qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u1qa2