Lineage for d1u1pa2 (1u1p A:99-190)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951989Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 2951990Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
    Uniprot P09651 7-188
  8. 2952002Domain d1u1pa2: 1u1p A:99-190 [197550]
    protein/DNA complex; protein/RNA complex

Details for d1u1pa2

PDB Entry: 1u1p (more details), 1.9 Å

PDB Description: crystal structure of up1 complexed with d(ttagggtta 2pr gg); a human telomeric repeat containing 2-aminopurine
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1u1pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1pa2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkalskqemasas

SCOPe Domain Coordinates for d1u1pa2:

Click to download the PDB-style file with coordinates for d1u1pa2.
(The format of our PDB-style files is described here.)

Timeline for d1u1pa2: