| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
| Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species) duplication: contains two domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries) Uniprot P09651 7-188 |
| Domain d1u1la1: 1u1l A:8-98 [197541] protein/DNA complex; protein/RNA complex |
PDB Entry: 1u1l (more details), 2 Å
SCOPe Domain Sequences for d1u1la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1la1 d.58.7.1 (A:8-98) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrp
Timeline for d1u1la1: