Lineage for d1t60u2 (1t60 U:115-226)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002102Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 3002103Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 3002104Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
    Uniprot P02462 1445-1667
  8. 3002158Domain d1t60u2: 1t60 U:115-226 [197536]
    automated match to d1m3df2
    complexed with cl, k, mpd

Details for d1t60u2

PDB Entry: 1t60 (more details), 1.5 Å

PDB Description: Crystal structure of Type IV collagen NC1 domain from bovine lens capsule
PDB Compounds: (U:) type iv collagen

SCOPe Domain Sequences for d1t60u2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t60u2 d.169.1.6 (U:115-226) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
iavhsqdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfiecn
gargtchyyankysfwlttipeqsfqgtpsadtlkaglirthisrcqvcmkn

SCOPe Domain Coordinates for d1t60u2:

Click to download the PDB-style file with coordinates for d1t60u2.
(The format of our PDB-style files is described here.)

Timeline for d1t60u2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t60u1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t60a1, d1t60a2, d1t60b1, d1t60b2, d1t60c1, d1t60c2, d1t60d1, d1t60d2, d1t60e1, d1t60e2, d1t60f1, d1t60f2, d1t60g1, d1t60g2, d1t60h1, d1t60h2, d1t60i1, d1t60i2, d1t60j1, d1t60j2, d1t60k1, d1t60k2, d1t60l1, d1t60l2, d1t60m1, d1t60m2, d1t60n1, d1t60n2, d1t60o1, d1t60o2, d1t60p1, d1t60p2, d1t60q1, d1t60q2, d1t60r1, d1t60r2, d1t60s1, d1t60s2, d1t60t1, d1t60t2, d1t60v1, d1t60v2, d1t60w1, d1t60w2, d1t60x1, d1t60x2