Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (1 protein) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains automatically mapped to Pfam PF01413 |
Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries) Uniprot P02462 1445-1667 |
Domain d1t60c1: 1t60 C:3-114 [197523] automated match to d1m3df1 complexed with cl, k, mpd |
PDB Entry: 1t60 (more details), 1.5 Å
SCOPe Domain Sequences for d1t60c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t60c1 d.169.1.6 (C:3-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} igyllvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpfl ycnpgdvcyyasrndksywlsttaplpmmpvaeedirpyisrcsvceapava
Timeline for d1t60c1:
View in 3D Domains from other chains: (mouse over for more information) d1t60a1, d1t60a2, d1t60b1, d1t60b2, d1t60d1, d1t60d2, d1t60e1, d1t60e2, d1t60f1, d1t60f2, d1t60g1, d1t60g2, d1t60h1, d1t60h2, d1t60i1, d1t60i2, d1t60j1, d1t60j2, d1t60k1, d1t60k2, d1t60l1, d1t60l2, d1t60m1, d1t60m2, d1t60n1, d1t60n2, d1t60o1, d1t60o2, d1t60p1, d1t60p2, d1t60q1, d1t60q2, d1t60r1, d1t60r2, d1t60s1, d1t60s2, d1t60t1, d1t60t2, d1t60u1, d1t60u2, d1t60v1, d1t60v2, d1t60w1, d1t60w2, d1t60x1, d1t60x2 |