Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
Domain d1t2ql2: 1t2q L:115-218 [197522] Other proteins in same PDB: d1t2qh1, d1t2ql1 automated match to d2jell2 complexed with gol, mes |
PDB Entry: 1t2q (more details), 1.83 Å
SCOPe Domain Sequences for d1t2ql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2ql2 b.1.1.2 (L:115-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d1t2ql2: