Lineage for d1t2ql2 (1t2q L:115-218)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763678Domain d1t2ql2: 1t2q L:115-218 [197522]
    Other proteins in same PDB: d1t2qh1, d1t2ql1
    automated match to d2jell2
    complexed with gol, mes

Details for d1t2ql2

PDB Entry: 1t2q (more details), 1.83 Å

PDB Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen
PDB Compounds: (L:) Fab NNA7 Heavy Chain

SCOPe Domain Sequences for d1t2ql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ql2 b.1.1.2 (L:115-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d1t2ql2:

Click to download the PDB-style file with coordinates for d1t2ql2.
(The format of our PDB-style files is described here.)

Timeline for d1t2ql2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t2ql1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t2qh1