SCOPe 2.03: Domain d1t2ql2: 1t2q L:115-218

Lineage for d1t2ql2 (1t2q L:115-218)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d1t2ql2: 1t2q L:115-218 [197522]
   Other proteins in same PDB: d1t2qh1, d1t2ql1
   automated match to d2jell2
   complexed with gol, mes

Details for d1t2ql2

PDB Entry: 1t2q, 1.83 Å

PDB Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen

PDB Compounds: (L:) Fab NNA7 Heavy Chain

SCOPe Domain Sequences for d1t2ql2:

Sequence; same for both SEQRES and ATOM records:

>d1t2ql2 b.1.1.2 (L:115-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1t2ql2:

• d1t2ql2 is new in SCOPe 2.03-stable
  
• d1t2ql2 appears in SCOPe 2.04
  
• d1t2ql2 appears in the current release, SCOPe 2.08