Lineage for d1t2ql1 (1t2q L:2-114)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290351Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
  8. 1290362Domain d1t2ql1: 1t2q L:2-114 [197521]
    Other proteins in same PDB: d1t2qh1, d1t2ql2
    automated match to d2jell1
    complexed with gol, mes

Details for d1t2ql1

PDB Entry: 1t2q (more details), 1.83 Å

PDB Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen
PDB Compounds: (L:) Fab NNA7 Heavy Chain

SCOPe Domain Sequences for d1t2ql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ql1 b.1.1.1 (L:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftltisrveaedlgvyycfqgshvpltfgagtklelkr

SCOPe Domain Coordinates for d1t2ql1:

Click to download the PDB-style file with coordinates for d1t2ql1.
(The format of our PDB-style files is described here.)

Timeline for d1t2ql1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t2ql2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t2qh1