SCOPe 2.03: Domain d1t2ql1: 1t2q L:2-114

Lineage for d1t2ql1 (1t2q L:2-114)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)

8. Domain d1t2ql1: 1t2q L:2-114 [197521]
   Other proteins in same PDB: d1t2qh1, d1t2ql2
   automated match to d2jell1
   complexed with gol, mes

Details for d1t2ql1

PDB Entry: 1t2q, 1.83 Å

PDB Description: The Crystal Structure of an NNA7 Fab that recognizes an N-type blood group antigen

PDB Compounds: (L:) Fab NNA7 Heavy Chain

SCOPe Domain Sequences for d1t2ql1:

Sequence; same for both SEQRES and ATOM records:

>d1t2ql1 b.1.1.1 (L:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftltisrveaedlgvyycfqgshvpltfgagtklelkr

Timeline for d1t2ql1:

• d1t2ql1 is new in SCOPe 2.03-stable
  
• d1t2ql1 appears in SCOPe 2.04
  
• d1t2ql1 appears in the current release, SCOPe 2.08