Lineage for d1svtl1 (1svt L:2-136,L:410-525)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345324Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2345325Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2345326Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 2345327Protein GroEL, E domain [48594] (4 species)
  7. 2345328Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. 2345431Domain d1svtl1: 1svt L:2-136,L:410-525 [197508]
    Other proteins in same PDB: d1svta2, d1svta3, d1svtb2, d1svtb3, d1svtc2, d1svtc3, d1svtd2, d1svtd3, d1svte2, d1svte3, d1svtf2, d1svtf3, d1svtg2, d1svtg3, d1svth2, d1svth3, d1svti2, d1svti3, d1svtj2, d1svtj3, d1svtk2, d1svtk3, d1svtl2, d1svtl3, d1svtm2, d1svtm3, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
    automated match to d1pcqa1
    complexed with adp, af3, k, mg

Details for d1svtl1

PDB Entry: 1svt (more details), 2.81 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7
PDB Compounds: (L:) groEL protein

SCOPe Domain Sequences for d1svtl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svtl1 a.129.1.1 (L:2-136,L:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOPe Domain Coordinates for d1svtl1:

Click to download the PDB-style file with coordinates for d1svtl1.
(The format of our PDB-style files is described here.)

Timeline for d1svtl1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1svta1, d1svta2, d1svta3, d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtf1, d1svtf2, d1svtf3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_