SCOP 1.57: Domain d1a64a_: 1a64 A:

Lineage for d1a64a_ (1a64 A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)

8. Domain d1a64a_: 1a64 A: [19750]

Details for d1a64a_

PDB Entry: 1a64, 2 Å

PDB Description: engineering a misfolded form of rat cd2

SCOP Domain Sequences for d1a64a_:

Sequence; same for both SEQRES and ATOM records:

>d1a64a_ b.1.1.1 (A:) CD2, first domain {Rat (Rattus norvegicus)}
gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
knltrddsgtynvtvystngtrildkaldlrile

Timeline for d1a64a_:

• d1a64a_ first appeared (with stable ids) in SCOP 1.55
  
• d1a64a_ appears in SCOP 1.59
  
• d1a64a_ appears in the current release, SCOPe 2.08